Target (protein/gene name): hypoxanthine phosphoribosyltransferase
*NCBI Gene # or RefSeq#: GI:23494985
*Protein ID (NP or XP #) or Wolbachia#: AAN35319.1
*Organism (including strain): Plasmodium falciparum 3D7
Etiologic Risk Group (see link below):
*/Disease Information (sort of like the Intro to your Mini Research Write up):
P. falciparum is a bacterium that causes malaria. Malaria causes flu- like symptoms with high fever, body aches, and chills. This particular stand of the bacterium causes malaria that progress into a more extreme form of malaria that causes fatal acute infections. This strain of the diease is mainly seen in Africa. Current treatments include: chloroquine, atovaquone-proguanil (Malarone®), artemether-lumefantrine (Coartem®),mefloquine (Lariam®), but all of these treatments are expensive.
Source: http://www.cdc.gov/malaria/diagnosis_treatment/treatment.html http://malaria.wellcome.ac.uk/doc_WTD023865.html
Link to TDR Targets page (if present): http://www.tdrtargets.org/targets/view?gene_id=1197
Link to Gene Database page (NCBI, EuPath databases -e.g. TryTryp, PlasmoDB, etc - or PATRIC, etc.): http://www.ncbi.nlm.nih.gov/protein/AAN35319.1
Essentiality of this protein: This protein is essential in the production of purine and pyrimidine bases.
Source: http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3319363/
Is it a monomer or multimer as biological unit? (make prediction at http://www.ebi.ac.uk/msd-srv/prot_int/pistart.html): 4 amino acid chains and 16 ligands in ASU
Complex of proteins?: Tetramer
Druggable Target (list number or cite evidence from a paper/database showing druggable in another organism): http://www.ncbi.nlm.nih.gov/pubmed/17149876
*EC#: 2.4.2.8
Link to BRENDA EC# page: http://www.brenda-enzymes.org/enzyme.php?ecno=2.4.2.8&Suchword=&organism%5B%5D=Plasmodium+falciparum&show_tm=0
-- Show screenshot of BRENDA enzyme mechanism schematic
Enzyme Assay information (spectrophotometric, coupled assay ?, reagents):
-- link to Sigma (or other company) page for assay (see Sigma links below)
Expression Information (has it been expressed in bacterial cells): E.Coli
Purification Method:
Image of protein (PyMol with features delineated and shown separately):
*Amino Acid Sequence (paste as text only - not as screenshot or as 'code'):
MPIPNNPGAGENAFDPVFVKDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYDIKKVYNNEEF
HILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGKHV
LIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKATSL
*length of your protein in Amino Acids: 231 amino Acids
Molecular Weight of your protein in kDaltons using the Expasy ProtParam website: 26.362 kDa
Molar Extinction coefficient of your protein at 280 nm wavelength: 23755
TMpred graph Image (http://www.ch.embnet.org/software/TMPRED_form.html). Input your amino acid sequence to it.:
*CDS Gene Sequence (paste as text only):
*GC% Content for gene:
*CDS Gene Sequence (codon optimized) - copy from output of Primer Design Protocol (paste as text only):
*GC% Content for gene (codon optimized):
Do Not Need this info for Spring (but still copy these lines to your Target page for now)
Primer design results for pNIC-Bsa4 cloning (list seqeunces of all of your ~40 nt long primers):
(link to DNA Works output text file - that should be saved in your Google Docs folder after you did the primer design protocol)
-- Ask a mentor, Dr. B, or a fellow researcher -how to link a GDocs file if you are not sure how to.
Primer design results for 'tail' primers (this is just 2 sequences):
*NCBI Gene # or RefSeq#: GI:23494985
*Protein ID (NP or XP #) or Wolbachia#: AAN35319.1
*Organism (including strain): Plasmodium falciparum 3D7
Etiologic Risk Group (see link below):
*/Disease Information (sort of like the Intro to your Mini Research Write up):
P. falciparum is a bacterium that causes malaria. Malaria causes flu- like symptoms with high fever, body aches, and chills. This particular stand of the bacterium causes malaria that progress into a more extreme form of malaria that causes fatal acute infections. This strain of the diease is mainly seen in Africa. Current treatments include: chloroquine, atovaquone-proguanil (Malarone®), artemether-lumefantrine (Coartem®),mefloquine (Lariam®), but all of these treatments are expensive.
Source: http://www.cdc.gov/malaria/diagnosis_treatment/treatment.html
http://malaria.wellcome.ac.uk/doc_WTD023865.html
Link to TDR Targets page (if present): http://www.tdrtargets.org/targets/view?gene_id=1197
Link to Gene Database page (NCBI, EuPath databases -e.g. TryTryp, PlasmoDB, etc - or PATRIC, etc.): http://www.ncbi.nlm.nih.gov/protein/AAN35319.1
Essentiality of this protein: This protein is essential in the production of purine and pyrimidine bases.
Source: http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3319363/
Is it a monomer or multimer as biological unit? (make prediction at http://www.ebi.ac.uk/msd-srv/prot_int/pistart.html): 4 amino acid chains and 16 ligands in ASU
Complex of proteins?: Tetramer
Druggable Target (list number or cite evidence from a paper/database showing druggable in another organism):
http://www.ncbi.nlm.nih.gov/pubmed/17149876
*EC#: 2.4.2.8
Link to BRENDA EC# page: http://www.brenda-enzymes.org/enzyme.php?ecno=2.4.2.8&Suchword=&organism%5B%5D=Plasmodium+falciparum&show_tm=0
-- Show screenshot of BRENDA enzyme mechanism schematic
Enzyme Assay information (spectrophotometric, coupled assay ?, reagents):
-- link to Sigma (or other company) page for assay (see Sigma links below)
http://www.sigmaaldrich.com/content/dam/sigma-aldrich/docs/Sigma/Enzyme_Assay/hypoxanthineguanine.pdf
-- links to assay reagents (substrates) pages.
--- List cost and quantity of substrate reagents, supplier, and catalog #
Structure (PDB or Homology model)
-- PDB # or closest PDB entry if using homology model: 1CJB
Current Inhibitors:
Purification Method:
Image of protein (PyMol with features delineated and shown separately):
*Amino Acid Sequence (paste as text only - not as screenshot or as 'code'):
MPIPNNPGAGENAFDPVFVKDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYDIKKVYNNEEF
HILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGKHV
LIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKATSL
*length of your protein in Amino Acids: 231 amino Acids
Molecular Weight of your protein in kDaltons using the Expasy ProtParam website: 26.362 kDa
Molar Extinction coefficient of your protein at 280 nm wavelength: 23755
TMpred graph Image (http://www.ch.embnet.org/software/TMPRED_form.html). Input your amino acid sequence to it.:
*CDS Gene Sequence (paste as text only):
*GC% Content for gene:
*CDS Gene Sequence (codon optimized) - copy from output of Primer Design Protocol (paste as text only):
*GC% Content for gene (codon optimized):
Do Not Need this info for Spring (but still copy these lines to your Target page for now)
Primer design results for pNIC-Bsa4 cloning (list seqeunces of all of your ~40 nt long primers):
(link to DNA Works output text file - that should be saved in your Google Docs folder after you did the primer design protocol)
-- Ask a mentor, Dr. B, or a fellow researcher -how to link a GDocs file if you are not sure how to.
Primer design results for 'tail' primers (this is just 2 sequences):
**